Lineage for d2d1ya1 (2d1y A:2-249)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151858Protein Hypothetical protein TTHA0369 [141896] (1 species)
    TT0321
  7. 1151859Species Thermus thermophilus [TaxId:274] [141897] (1 PDB entry)
    Uniprot Q5SLC4 2-249
  8. 1151860Domain d2d1ya1: 2d1y A:2-249 [131151]
    Other proteins in same PDB: d2d1yb_, d2d1yc_, d2d1yd_
    complexed with nad

Details for d2d1ya1

PDB Entry: 2d1y (more details), 1.65 Å

PDB Description: crystal structure of tt0321 from thermus thermophilus hb8
PDB Compounds: (A:) hypothetical protein TT0321

SCOPe Domain Sequences for d2d1ya1:

Sequence, based on SEQRES records: (download)

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}
glfagkgvlvtggargigraiaqafaregalvalcdlrpegkevaeaiggaffqvdlede
rervrfveeaayalgrvdvlvnnaaiaapgsaltvrlpewrrvlevnltapmhlsalaar
emrkvgggaivnvasvqglfaeqenaaynaskgglvnltrslaldlaplrirvnavapga
iateavleaialspdpertrrdwedlhalrrlgkpeevaeavlflasekasfitgailpv
dggmtasf

Sequence, based on observed residues (ATOM records): (download)

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}
glfagkgvlvtggargigraiaqafaregalvalcdlrpegkevaeaiggaffqvdlede
rervrfveeaayalgrvdvlvnnaaiaapgsaltvrlpewrrvlevnltapmhlsalaar
emrkvgggaivnvasvqglfaeqenaaynaskgglvnltrslaldlaplrirvnavapga
iateavleaiarrdwedlhalrrlgkpeevaeavlflasekasfitgailpvdggmtasf

SCOPe Domain Coordinates for d2d1ya1:

Click to download the PDB-style file with coordinates for d2d1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2d1ya1: