Lineage for d2d1pi1 (2d1p I:1-95)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712706Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 712707Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 712736Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 712745Protein tRNA 2-thiouridine synthesizing protein B, TusB [142106] (1 species)
    formerly hypothetical protein YheL
  7. 712746Species Escherichia coli [TaxId:562] [142107] (1 PDB entry)
  8. 712749Domain d2d1pi1: 2d1p I:1-95 [131144]
    Other proteins in same PDB: d2d1pa1, d2d1pb1, d2d1pd1, d2d1pe1, d2d1pg1, d2d1ph1
    automatically matched to 2D1P C:1-95
    complexed with so4

Details for d2d1pi1

PDB Entry: 2d1p (more details), 2.15 Å

PDB Description: crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification
PDB Compounds: (I:) Hypothetical protein yheL

SCOP Domain Sequences for d2d1pi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1pi1 c.114.1.2 (I:1-95) tRNA 2-thiouridine synthesizing protein B, TusB {Escherichia coli [TaxId: 562]}
mlhtlhrspwltdfaallrllsegdellllqdgvtaavdgnryleslrnapikvyalned
liargltgqisndiilidytdfvrltvkhpsqmaw

SCOP Domain Coordinates for d2d1pi1:

Click to download the PDB-style file with coordinates for d2d1pi1.
(The format of our PDB-style files is described here.)

Timeline for d2d1pi1: