| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (2 families) ![]() |
| Family c.114.1.2: DsrH-like [117489] (3 proteins) Pfam PF04077 |
| Protein tRNA 2-thiouridine synthesizing protein B, TusB [142106] (1 species) formerly hypothetical protein YheL |
| Species Escherichia coli [TaxId:562] [142107] (1 PDB entry) |
| Domain d2d1pi1: 2d1p I:1-95 [131144] Other proteins in same PDB: d2d1pa1, d2d1pb1, d2d1pd1, d2d1pe1, d2d1pg1, d2d1ph1 automatically matched to 2D1P C:1-95 complexed with so4 |
PDB Entry: 2d1p (more details), 2.15 Å
SCOP Domain Sequences for d2d1pi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1pi1 c.114.1.2 (I:1-95) tRNA 2-thiouridine synthesizing protein B, TusB {Escherichia coli [TaxId: 562]}
mlhtlhrspwltdfaallrllsegdellllqdgvtaavdgnryleslrnapikvyalned
liargltgqisndiilidytdfvrltvkhpsqmaw
Timeline for d2d1pi1: