Lineage for d2d1ph_ (2d1p H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921138Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2921139Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2921140Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 2921170Protein tRNA 2-thiouridine synthesizing protein C, TusC [142104] (1 species)
    formerly hypothetical protein YheM
  7. 2921171Species Escherichia coli [TaxId:562] [142105] (1 PDB entry)
    Uniprot P45531 1-119
  8. 2921174Domain d2d1ph_: 2d1p H: [131143]
    Other proteins in same PDB: d2d1pa1, d2d1pa2, d2d1pc1, d2d1pd2, d2d1pd3, d2d1pf_, d2d1pg2, d2d1pg3, d2d1pi_
    automated match to d2d1pb1
    complexed with so4

Details for d2d1ph_

PDB Entry: 2d1p (more details), 2.15 Å

PDB Description: crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification
PDB Compounds: (H:) Hypothetical UPF0116 protein yheM

SCOPe Domain Sequences for d2d1ph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1ph_ c.114.1.1 (H:) tRNA 2-thiouridine synthesizing protein C, TusC {Escherichia coli [TaxId: 562]}
kriafvfstaphgtaagregldallatsaltddlavffiadgvfqllpgqkpdavlardy
iatfkllglydieqcwvcaaslrergldpqtpfvveatpleadalrrelanydvilrf

SCOPe Domain Coordinates for d2d1ph_:

Click to download the PDB-style file with coordinates for d2d1ph_.
(The format of our PDB-style files is described here.)

Timeline for d2d1ph_: