Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (3 families) |
Family c.114.1.1: DsrEF-like [75170] (6 proteins) Pfam PF02635 |
Protein tRNA 2-thiouridine synthesizing protein D, TusD [142100] (1 species) formerly hypothetical protein YheN |
Species Escherichia coli [TaxId:562] [142101] (1 PDB entry) Uniprot P45532 1-128 |
Domain d2d1pd_: 2d1p D: [131139] Other proteins in same PDB: d2d1pb1, d2d1pc1, d2d1pe_, d2d1pf_, d2d1ph_, d2d1pi_ automated match to d2d1pa1 complexed with so4 |
PDB Entry: 2d1p (more details), 2.15 Å
SCOPe Domain Sequences for d2d1pd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1pd_ c.114.1.1 (D:) tRNA 2-thiouridine synthesizing protein D, TusD {Escherichia coli [TaxId: 562]} gsmrfaivvtgpaygtqqassafqfaqaliadghelssvffyregvynanqltspasdef dlvrawqqlnaqhgvalnicvaaalrrgvvdeteagrlglassnlqqgftlsglgalaea sltcdrvvqf
Timeline for d2d1pd_: