Lineage for d2d1pd_ (2d1p D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884580Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 1884581Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 1884582Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 1884617Protein tRNA 2-thiouridine synthesizing protein D, TusD [142100] (1 species)
    formerly hypothetical protein YheN
  7. 1884618Species Escherichia coli [TaxId:562] [142101] (1 PDB entry)
    Uniprot P45532 1-128
  8. 1884620Domain d2d1pd_: 2d1p D: [131139]
    Other proteins in same PDB: d2d1pb1, d2d1pc1, d2d1pe_, d2d1pf_, d2d1ph_, d2d1pi_
    automated match to d2d1pa1
    complexed with so4

Details for d2d1pd_

PDB Entry: 2d1p (more details), 2.15 Å

PDB Description: crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification
PDB Compounds: (D:) Hypothetical UPF0163 protein yheN

SCOPe Domain Sequences for d2d1pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1pd_ c.114.1.1 (D:) tRNA 2-thiouridine synthesizing protein D, TusD {Escherichia coli [TaxId: 562]}
gsmrfaivvtgpaygtqqassafqfaqaliadghelssvffyregvynanqltspasdef
dlvrawqqlnaqhgvalnicvaaalrrgvvdeteagrlglassnlqqgftlsglgalaea
sltcdrvvqf

SCOPe Domain Coordinates for d2d1pd_:

Click to download the PDB-style file with coordinates for d2d1pd_.
(The format of our PDB-style files is described here.)

Timeline for d2d1pd_: