Lineage for d2d1pd1 (2d1p D:1-128)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712706Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 712707Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 712708Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 712731Protein tRNA 2-thiouridine synthesizing protein D, TusD [142100] (1 species)
    formerly hypothetical protein YheN
  7. 712732Species Escherichia coli [TaxId:562] [142101] (1 PDB entry)
  8. 712734Domain d2d1pd1: 2d1p D:1-128 [131139]
    Other proteins in same PDB: d2d1pb1, d2d1pc1, d2d1pe1, d2d1pf1, d2d1ph1, d2d1pi1
    automatically matched to 2D1P A:1-128
    complexed with so4

Details for d2d1pd1

PDB Entry: 2d1p (more details), 2.15 Å

PDB Description: crystal structure of heterohexameric TusBCD proteins, which are crucial for the tRNA modification
PDB Compounds: (D:) Hypothetical UPF0163 protein yheN

SCOP Domain Sequences for d2d1pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1pd1 c.114.1.1 (D:1-128) tRNA 2-thiouridine synthesizing protein D, TusD {Escherichia coli [TaxId: 562]}
mrfaivvtgpaygtqqassafqfaqaliadghelssvffyregvynanqltspasdefdl
vrawqqlnaqhgvalnicvaaalrrgvvdeteagrlglassnlqqgftlsglgalaeasl
tcdrvvqf

SCOP Domain Coordinates for d2d1pd1:

Click to download the PDB-style file with coordinates for d2d1pd1.
(The format of our PDB-style files is described here.)

Timeline for d2d1pd1: