| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (2 families) ![]() |
| Family c.114.1.1: DsrEF-like [75170] (6 proteins) Pfam PF02635 |
| Protein tRNA 2-thiouridine synthesizing protein D, TusD [142100] (1 species) formerly hypothetical protein YheN |
| Species Escherichia coli [TaxId:562] [142101] (1 PDB entry) |
| Domain d2d1pd1: 2d1p D:1-128 [131139] Other proteins in same PDB: d2d1pb1, d2d1pc1, d2d1pe1, d2d1pf1, d2d1ph1, d2d1pi1 automatically matched to 2D1P A:1-128 complexed with so4 |
PDB Entry: 2d1p (more details), 2.15 Å
SCOP Domain Sequences for d2d1pd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1pd1 c.114.1.1 (D:1-128) tRNA 2-thiouridine synthesizing protein D, TusD {Escherichia coli [TaxId: 562]}
mrfaivvtgpaygtqqassafqfaqaliadghelssvffyregvynanqltspasdefdl
vrawqqlnaqhgvalnicvaaalrrgvvdeteagrlglassnlqqgftlsglgalaeasl
tcdrvvqf
Timeline for d2d1pd1: