Lineage for d2d1oa_ (2d1o A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571173Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2571174Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2571181Domain d2d1oa_: 2d1o A: [131134]
    automated match to d1b3db_
    complexed with ca, fa4, zn

Details for d2d1oa_

PDB Entry: 2d1o (more details), 2.02 Å

PDB Description: Stromelysin-1 (MMP-3) complexed to a hydroxamic acid inhibitor
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d2d1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1oa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdsp

SCOPe Domain Coordinates for d2d1oa_:

Click to download the PDB-style file with coordinates for d2d1oa_.
(The format of our PDB-style files is described here.)

Timeline for d2d1oa_: