Lineage for d2d1oa1 (2d1o A:83-253)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729492Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 729493Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (32 PDB entries)
  8. 729504Domain d2d1oa1: 2d1o A:83-253 [131134]
    automatically matched to d1b3db_
    complexed with ca, fa4, zn

Details for d2d1oa1

PDB Entry: 2d1o (more details), 2.02 Å

PDB Description: Stromelysin-1 (MMP-3) complexed to a hydroxamic acid inhibitor
PDB Compounds: (A:) stromelysin-1

SCOP Domain Sequences for d2d1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1oa1 d.92.1.11 (A:83-253) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdsp

SCOP Domain Coordinates for d2d1oa1:

Click to download the PDB-style file with coordinates for d2d1oa1.
(The format of our PDB-style files is described here.)

Timeline for d2d1oa1: