SCOPe 2.06: Domain d2d1kb_: 2d1k B:

Lineage for d2d1kb_ (2d1k B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein Deoxyribonuclease I [56225] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)

8. Domain d2d1kb_: 2d1k B: [131131]
   Other proteins in same PDB: d2d1ka1, d2d1ka2
   automated match to d1dnka_
   protein/DNA complex; complexed with atp, ca, mg

Details for d2d1kb_

PDB Entry: 2d1k, 2.5 Å

PDB Description: ternary complex of the wh2 domain of mim with actin-dnase i

PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d2d1kb_:

Sequence; same for both SEQRES and ATOM records:

>d2d1kb_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

Timeline for d2d1kb_:

• d2d1kb_ first appeared in SCOP 1.73, called d2d1kb1
  
• d2d1kb_ appears in SCOPe 2.05
  
• d2d1kb_ appears in SCOPe 2.07
  
• d2d1kb_ appears in the current release, SCOPe 2.08