Lineage for d2d1ha1 (2d1h A:1-109)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983364Family a.4.5.50: TrmB-like [109680] (2 protein domains)
    The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families
  6. 1983369Protein Hypothetical transcriptional regulator ST1889 [140273] (1 species)
  7. 1983370Species Sulfolobus tokodaii [TaxId:111955] [140274] (1 PDB entry)
    Uniprot Q96ZE4 1-109
  8. 1983371Domain d2d1ha1: 2d1h A:1-109 [131125]

Details for d2d1ha1

PDB Entry: 2d1h (more details), 2.05 Å

PDB Description: Crystal structure of ST1889 protein from thermoacidophilic archaeon Sulfolobus tokodaii
PDB Compounds: (A:) 109aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2d1ha1:

Sequence, based on SEQRES records: (download)

>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat

Sequence, based on observed residues (ATOM records): (download)

>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktpkyyysissnilekirndllncakrmelaat

SCOPe Domain Coordinates for d2d1ha1:

Click to download the PDB-style file with coordinates for d2d1ha1.
(The format of our PDB-style files is described here.)

Timeline for d2d1ha1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d1hb_