Lineage for d2d13d_ (2d13 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861391Protein automated matches [190257] (5 species)
    not a true protein
  7. 2861395Species Pyrococcus horikoshii [TaxId:53953] [187044] (1 PDB entry)
  8. 2861398Domain d2d13d_: 2d13 D: [131124]
    Other proteins in same PDB: d2d13a1
    automated match to d1ru8a_

Details for d2d13d_

PDB Entry: 2d13 (more details), 2.4 Å

PDB Description: Crystal Structure of PH1257 from Pyrococcus horikoshii OT3
PDB Compounds: (D:) hypothetical protein PH1257

SCOPe Domain Sequences for d2d13d_:

Sequence, based on SEQRES records: (download)

>d2d13d_ c.26.2.1 (D:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
ladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqaralg
ipiikgftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvytpa
wekdpyqymleiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihiage
ggefetfvldmpffkakividdaekfwdglsgkfiikrahlewk

Sequence, based on observed residues (ATOM records): (download)

>d2d13d_ c.26.2.1 (D:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
ladvavlysggkdsnyalywalksglrvrylvsmvsltslqaralgipiikgftvedlkn
vleglkvdgivagalasryqkerienvarelglkvytpawekdpyqymleiiklgfkvvf
vavsayglneswlgrelnyknleelkklsekygihiageggefetfvldmpffkakivid
daekfwdglsgkfiikrahlewk

SCOPe Domain Coordinates for d2d13d_:

Click to download the PDB-style file with coordinates for d2d13d_.
(The format of our PDB-style files is described here.)

Timeline for d2d13d_: