Lineage for d2d13c1 (2d13 C:3-227)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827807Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 827808Family c.26.2.1: N-type ATP pyrophosphatases [52403] (8 proteins)
  6. 827882Protein Hypothetical protein PH1257 [142085] (1 species)
    probable orthologue of PF0828
  7. 827883Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142086] (1 PDB entry)
    Uniprot O58996 2-227
  8. 827886Domain d2d13c1: 2d13 C:3-227 [131123]
    automatically matched to 2D13 A:2-227

Details for d2d13c1

PDB Entry: 2d13 (more details), 2.4 Å

PDB Description: Crystal Structure of PH1257 from Pyrococcus horikoshii OT3
PDB Compounds: (C:) hypothetical protein PH1257

SCOP Domain Sequences for d2d13c1:

Sequence, based on SEQRES records: (download)

>d2d13c1 c.26.2.1 (C:3-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
gladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqaral
gipiikgftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvytp
awekdpyqymleiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihiag
eggefetfvldmpffkakividdaekfwdglsgkfiikrahlewk

Sequence, based on observed residues (ATOM records): (download)

>d2d13c1 c.26.2.1 (C:3-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
gladvavlysggkdsnyalywalksglrvrylvsmvseeltslqaralgipiikgftkke
vedlknvleglkvdgivagalasryqkerienvarelglkvytpawekdpyqymleiikl
gfkvvfvavsayglneswlgrelnyknleelkklsekygihiageggefetfvldmpffk
akividdaekfwdglsgkfiikrahlewk

SCOP Domain Coordinates for d2d13c1:

Click to download the PDB-style file with coordinates for d2d13c1.
(The format of our PDB-style files is described here.)

Timeline for d2d13c1: