Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein automated matches [190257] (5 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [187044] (1 PDB entry) |
Domain d2d13c_: 2d13 C: [131123] Other proteins in same PDB: d2d13a1 automated match to d1ru8a_ |
PDB Entry: 2d13 (more details), 2.4 Å
SCOPe Domain Sequences for d2d13c_:
Sequence, based on SEQRES records: (download)
>d2d13c_ c.26.2.1 (C:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} gladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqaral gipiikgftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvytp awekdpyqymleiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihiag eggefetfvldmpffkakividdaekfwdglsgkfiikrahlewk
>d2d13c_ c.26.2.1 (C:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} gladvavlysggkdsnyalywalksglrvrylvsmvseeltslqaralgipiikgftkke vedlknvleglkvdgivagalasryqkerienvarelglkvytpawekdpyqymleiikl gfkvvfvavsayglneswlgrelnyknleelkklsekygihiageggefetfvldmpffk akividdaekfwdglsgkfiikrahlewk
Timeline for d2d13c_: