SCOPe 2.08: Domain d2d13b_: 2d13 B:

Lineage for d2d13b_ (2d13 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein automated matches [190257] (5 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [187044] (1 PDB entry)

8. Domain d2d13b_: 2d13 B: [131122]
   Other proteins in same PDB: d2d13a1
   automated match to d1ru8a_

Details for d2d13b_

PDB Entry: 2d13, 2.4 Å

PDB Description: Crystal Structure of PH1257 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) hypothetical protein PH1257

SCOPe Domain Sequences for d2d13b_:

Sequence, based on SEQRES records:

>d2d13b_ c.26.2.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vgladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqara
lgipiikgftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvyt
pawekdpyqymleiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihia
geggefetfvldmpffkakividdaekfwdglsgkfiikrahlewk

Sequence, based on observed residues (ATOM records):

>d2d13b_ c.26.2.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vgladvavlysggkdsnyalywalksglrvrylvsmvsenveltslqaralgipiikgft
evedlknvleglkvdgivagalqkerienvarelglkvytpawekdpyqymleiiklgfk
vvfvavsayglneswlgrelnyknleelkklsekygihiageggefetfvldmpffkaki
viddaekfwdglsgkfiikrahlewk

Timeline for d2d13b_:

• d2d13b_ first appeared in SCOP 1.73, called d2d13b1
  
• d2d13b_ appears in SCOPe 2.07