Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein Hypothetical protein PH1257 [142085] (1 species) probable orthologue of PF0828 |
Species Pyrococcus horikoshii [TaxId:53953] [142086] (1 PDB entry) Uniprot O58996 2-227 |
Domain d2d13a1: 2d13 A:2-227 [131121] Other proteins in same PDB: d2d13b_, d2d13c_, d2d13d_ |
PDB Entry: 2d13 (more details), 2.4 Å
SCOPe Domain Sequences for d2d13a1:
Sequence, based on SEQRES records: (download)
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Pyrococcus horikoshii [TaxId: 53953]} vgladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqara lgipiikgftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvyt pawekdpyqymleiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihia geggefetfvldmpffkakividdaekfwdglsgkfiikrahlewk
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Pyrococcus horikoshii [TaxId: 53953]} vgladvavlysggkdsnyalywalksglrvrylvsmvsennveltslqaralgipiikgf tekekevedlknvleglkvdgivagalasryqkerienvarelglkvytpawekdpyqym leiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihiageggefetfvl dmpffkakividdaekfwdglsgkfiikrahlewk
Timeline for d2d13a1: