SCOPe 2.03: Domain d2d13a1: 2d13 A:2-227

Lineage for d2d13a1 (2d13 A:2-227)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Hypothetical protein PH1257 [142085] (1 species)
   probable orthologue of PF0828

7. Species Pyrococcus horikoshii [TaxId:53953] [142086] (1 PDB entry)
   Uniprot O58996 2-227

8. Domain d2d13a1: 2d13 A:2-227 [131121]
   Other proteins in same PDB: d2d13b_, d2d13c_, d2d13d_

Details for d2d13a1

PDB Entry: 2d13, 2.4 Å

PDB Description: Crystal Structure of PH1257 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH1257

SCOPe Domain Sequences for d2d13a1:

Sequence, based on SEQRES records:

>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Pyrococcus horikoshii [TaxId: 53953]}
vgladvavlysggkdsnyalywalksglrvrylvsmvseneesymyhtpnveltslqara
lgipiikgftkgekekevedlknvleglkvdgivagalasryqkerienvarelglkvyt
pawekdpyqymleiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihia
geggefetfvldmpffkakividdaekfwdglsgkfiikrahlewk

Sequence, based on observed residues (ATOM records):

>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Pyrococcus horikoshii [TaxId: 53953]}
vgladvavlysggkdsnyalywalksglrvrylvsmvsennveltslqaralgipiikgf
tekekevedlknvleglkvdgivagalasryqkerienvarelglkvytpawekdpyqym
leiiklgfkvvfvavsayglneswlgrelnyknleelkklsekygihiageggefetfvl
dmpffkakividdaekfwdglsgkfiikrahlewk

Timeline for d2d13a1:

• d2d13a1 first appeared in SCOP 1.73
  
• d2d13a1 appears in SCOPe 2.02
  
• d2d13a1 appears in SCOPe 2.04
  
• d2d13a1 appears in the current release, SCOPe 2.08