Lineage for d2d11a2 (2d11 A:199-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803573Protein Radixin [50779] (1 species)
  7. 2803574Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. 2803582Domain d2d11a2: 2d11 A:199-296 [131110]
    Other proteins in same PDB: d2d11a1, d2d11a3, d2d11b1, d2d11b3, d2d11c1, d2d11c3, d2d11d1, d2d11d3
    automatically matched to d1gc6a2

Details for d2d11a2

PDB Entry: 2d11 (more details), 2.81 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail peptide
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2d11a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d11a2 b.55.1.5 (A:199-296) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrk

SCOPe Domain Coordinates for d2d11a2:

Click to download the PDB-style file with coordinates for d2d11a2.
(The format of our PDB-style files is described here.)

Timeline for d2d11a2: