SCOPe 2.08: Domain d2d0qb_: 2d0q B:

Lineage for d2d0qb_ (2d0q B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2d0qb_: 2d0q B: [131092]
   Other proteins in same PDB: d2d0qa_
   automated match to d2ahjd_
   complexed with cyi, fe, mg

Details for d2d0qb_

PDB Entry: 2d0q, 1.65 Å

PDB Description: Complex of Fe-type NHase with Cyclohexyl isocyanide, photo-activated for 1hr at 277K

PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d2d0qb_:

Sequence; same for both SEQRES and ATOM records:

>d2d0qb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

Timeline for d2d0qb_:

• d2d0qb_ first appeared in SCOP 1.73, called d2d0qb1
  
• d2d0qb_ appears in SCOPe 2.07