Lineage for d2d0qa1 (2d0q A:14-203)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735651Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 735652Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 735653Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 735663Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 735664Species Rhodococcus erythropolis [TaxId:1833] [56212] (7 PDB entries)
    also Rhodococcus sp. R312
  8. 735668Domain d2d0qa1: 2d0q A:14-203 [131091]
    Other proteins in same PDB: d2d0qb1
    automatically matched to d2ahja_
    complexed with cyi, fe, mg

Details for d2d0qa1

PDB Entry: 2d0q (more details), 1.65 Å

PDB Description: Complex of Fe-type NHase with Cyclohexyl isocyanide, photo-activated for 1hr at 277K
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOP Domain Sequences for d2d0qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0qa1 d.149.1.1 (A:14-203) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
aqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpefrqll
ltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyksfeyr
arvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkd
cligvaipqv

SCOP Domain Coordinates for d2d0qa1:

Click to download the PDB-style file with coordinates for d2d0qa1.
(The format of our PDB-style files is described here.)

Timeline for d2d0qa1: