Lineage for d2d0qa_ (2d0q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987858Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2987859Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2987860Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2987880Protein automated matches [190256] (6 species)
    not a true protein
  7. 2987913Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)
  8. 2987930Domain d2d0qa_: 2d0q A: [131091]
    Other proteins in same PDB: d2d0qb_
    automated match to d2ahja_
    complexed with cyi, fe, mg

Details for d2d0qa_

PDB Entry: 2d0q (more details), 1.65 Å

PDB Description: Complex of Fe-type NHase with Cyclohexyl isocyanide, photo-activated for 1hr at 277K
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2d0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0qa_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
aqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpefrqll
ltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyksfeyr
arvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqeivtkd
cligvaipqvpt

SCOPe Domain Coordinates for d2d0qa_:

Click to download the PDB-style file with coordinates for d2d0qa_.
(The format of our PDB-style files is described here.)

Timeline for d2d0qa_: