![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) ![]() |
![]() | Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (2 proteins) |
![]() | Protein Diol dehydratase-reactivating factor small subunit DdrB [142424] (1 species) |
![]() | Species Klebsiella oxytoca [TaxId:571] [142425] (2 PDB entries) Uniprot O68196 5-112 |
![]() | Domain d2d0pd1: 2d0p D:5-112 [131090] Other proteins in same PDB: d2d0pa1, d2d0pa2, d2d0pa3, d2d0pc1, d2d0pc2, d2d0pc3 automatically matched to 2D0O B:5-112 complexed with ca, so4 |
PDB Entry: 2d0p (more details), 3 Å
SCOP Domain Sequences for d2d0pd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0pd1 c.51.3.2 (D:5-112) Diol dehydratase-reactivating factor small subunit DdrB {Klebsiella oxytoca [TaxId: 571]} hsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgia cdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfr
Timeline for d2d0pd1: