| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.6: ATPase domain of dehydratase reactivase alpha subunit [82440] (2 proteins) |
| Protein Diol dehydratase-reactivating factor large subunit DdrA [142464] (1 species) |
| Species Klebsiella oxytoca [TaxId:571] [142465] (2 PDB entries) |
| Domain d2d0pc3: 2d0p C:404-605 [131089] Other proteins in same PDB: d2d0pa1, d2d0pb1, d2d0pc1, d2d0pd1 automatically matched to 2D0O A:404-606 complexed with ca, so4 |
PDB Entry: 2d0p (more details), 3 Å
SCOP Domain Sequences for d2d0pc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0pc3 c.55.1.6 (C:404-605) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]}
gttrplaildlgagstdasiinpkgdiiathlagagdmvtmiiarelgledrylaeeikk
yplakveslfhlrhedgsvqffstplppavfarvcvvkadelvplpgdlalekvrairrs
akervfvtnalralrqvsptgnirdipfvvlvggssldfevpqlvtdalahyrlvagrgn
irgsegprnavatglilswhke
Timeline for d2d0pc3: