Lineage for d2d0pc2 (2d0p C:1-92,C:255-403)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836475Family c.55.1.6: ATPase domain of dehydratase reactivase alpha subunit [82440] (2 proteins)
  6. 836482Protein Diol dehydratase-reactivating factor large subunit DdrA [142464] (1 species)
  7. 836483Species Klebsiella oxytoca [TaxId:571] [142465] (2 PDB entries)
    Uniprot O68195 1-92,255-403! Uniprot O68195 404-606
  8. 836490Domain d2d0pc2: 2d0p C:1-92,C:255-403 [131088]
    Other proteins in same PDB: d2d0pa1, d2d0pb1, d2d0pc1, d2d0pd1
    automatically matched to 2D0O A:1-92,A:255-403
    complexed with ca, so4

Details for d2d0pc2

PDB Entry: 2d0p (more details), 3 Å

PDB Description: structure of diol dehydratase-reactivating factor in nucleotide free form
PDB Compounds: (C:) diol dehydratase-reactivating factor large subunit

SCOP Domain Sequences for d2d0pc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0pc2 c.55.1.6 (C:1-92,C:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]}
mryiagidignsstevalatldeagaltithsalaettgikgtlrnvfgiqealalvarg
agiavsdislirineatpvigdvametitetiXkaraipagnlellaqgrsvrvdvaaga
eaimkavdgcgrldnvtgesgtniggmlehvrqtmaeltnkpsseifiqdllavdtsvpv
svtgglagefsleqavgiasmvksdrlqmamiareieqklnidvqiggaeaeaailgalt
tp

SCOP Domain Coordinates for d2d0pc2:

Click to download the PDB-style file with coordinates for d2d0pc2.
(The format of our PDB-style files is described here.)

Timeline for d2d0pc2: