![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.6: Swiveling domain of dehydratase reactivase alpha subunit [82317] (1 family) ![]() |
![]() | Family c.8.6.1: Swiveling domain of dehydratase reactivase alpha subunit [82318] (2 proteins) |
![]() | Protein Diol dehydratase-reactivating factor large subunit DdrA [141982] (1 species) |
![]() | Species Klebsiella oxytoca [TaxId:571] [141983] (2 PDB entries) Uniprot O68195 93-254 |
![]() | Domain d2d0pc1: 2d0p C:93-254 [131087] Other proteins in same PDB: d2d0pa2, d2d0pa3, d2d0pb1, d2d0pc2, d2d0pc3, d2d0pd1 automatically matched to 2D0O A:93-254 complexed with ca, so4 |
PDB Entry: 2d0p (more details), 3 Å
SCOP Domain Sequences for d2d0pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0pc1 c.8.6.1 (C:93-254) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} itestmighnpktpggaglgtgititpqelltrpadapyilvvssafdfadiasvinasl ragyqitgvilqrddgvlvsnrlekplpivdevlyidriplgmlaaievavpgkvietls npygiatvfnlspeetknivpmaralignrsavvvktpsgdv
Timeline for d2d0pc1: