SCOP 1.75: Domain d2d0od1: 2d0o D:6-112

Lineage for d2d0od1 (2d0o D:6-112)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families)

5. Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (2 proteins)

6. Protein Diol dehydratase-reactivating factor small subunit DdrB [142424] (1 species)

7. Species Klebsiella oxytoca [TaxId:571] [142425] (2 PDB entries)
   Uniprot O68196 5-112

8. Domain d2d0od1: 2d0o D:6-112 [131082]
   Other proteins in same PDB: d2d0oa1, d2d0oa2, d2d0oa3, d2d0oc1, d2d0oc2, d2d0oc3
   automatically matched to 2D0O B:5-112
   complexed with adp, mg, so4

Details for d2d0od1

PDB Entry: 2d0o, 2 Å

PDB Description: structure of diol dehydratase-reactivating factor complexed with adp and mg2+

PDB Compounds: (D:) diol dehydratase-reactivating factor small subunit

SCOP Domain Sequences for d2d0od1:

Sequence; same for both SEQRES and ATOM records:

>d2d0od1 c.51.3.2 (D:6-112) Diol dehydratase-reactivating factor small subunit DdrB {Klebsiella oxytoca [TaxId: 571]}
sapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgiac
drhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfr

Timeline for d2d0od1:

• d2d0od1 first appeared in SCOP 1.73
  
• d2d0od1 is called d2d0od_ in SCOPe 2.01
  
• d2d0od1 appears in the current release, SCOPe 2.08, called d2d0od_