Lineage for d2d0oc1 (2d0o C:93-254)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110823Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2111278Superfamily c.8.6: Swiveling domain of dehydratase reactivase alpha subunit [82317] (1 family) (S)
  5. 2111279Family c.8.6.1: Swiveling domain of dehydratase reactivase alpha subunit [82318] (2 proteins)
  6. 2111280Protein Diol dehydratase-reactivating factor large subunit DdrA [141982] (1 species)
  7. 2111281Species Klebsiella oxytoca [TaxId:571] [141983] (2 PDB entries)
    Uniprot O68195 93-254
  8. 2111283Domain d2d0oc1: 2d0o C:93-254 [131079]
    Other proteins in same PDB: d2d0oa2, d2d0oa3, d2d0ob1, d2d0oc2, d2d0oc3, d2d0od_
    automated match to d2d0oa1
    complexed with adp, mg, so4

Details for d2d0oc1

PDB Entry: 2d0o (more details), 2 Å

PDB Description: structure of diol dehydratase-reactivating factor complexed with adp and mg2+
PDB Compounds: (C:) diol dehydratase-reactivating factor large subunit

SCOPe Domain Sequences for d2d0oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0oc1 c.8.6.1 (C:93-254) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]}
itestmighnpktpggaglgtgititpqelltrpadapyilvvssafdfadiasvinasl
ragyqitgvilqrddgvlvsnrlekplpivdevlyidriplgmlaaievavpgkvietls
npygiatvfnlspeetknivpmaralignrsavvvktpsgdv

SCOPe Domain Coordinates for d2d0oc1:

Click to download the PDB-style file with coordinates for d2d0oc1.
(The format of our PDB-style files is described here.)

Timeline for d2d0oc1: