Lineage for d2d0ob1 (2d0o B:5-112)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994169Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 994301Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 994324Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (3 proteins)
  6. 994325Protein Diol dehydratase-reactivating factor small subunit DdrB [142424] (1 species)
  7. 994326Species Klebsiella oxytoca [TaxId:571] [142425] (2 PDB entries)
    Uniprot O68196 5-112
  8. 994327Domain d2d0ob1: 2d0o B:5-112 [131078]
    Other proteins in same PDB: d2d0oa1, d2d0oa2, d2d0oa3, d2d0oc1, d2d0oc2, d2d0oc3, d2d0od_
    complexed with adp, mg, so4

Details for d2d0ob1

PDB Entry: 2d0o (more details), 2 Å

PDB Description: structure of diol dehydratase-reactivating factor complexed with adp and mg2+
PDB Compounds: (B:) diol dehydratase-reactivating factor small subunit

SCOPe Domain Sequences for d2d0ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0ob1 c.51.3.2 (B:5-112) Diol dehydratase-reactivating factor small subunit DdrB {Klebsiella oxytoca [TaxId: 571]}
hsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgia
cdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfr

SCOPe Domain Coordinates for d2d0ob1:

Click to download the PDB-style file with coordinates for d2d0ob1.
(The format of our PDB-style files is described here.)

Timeline for d2d0ob1: