| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) ![]() |
| Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (3 proteins) |
| Protein Diol dehydratase-reactivating factor small subunit DdrB [142424] (1 species) |
| Species Klebsiella oxytoca [TaxId:571] [142425] (2 PDB entries) Uniprot O68196 5-112 |
| Domain d2d0ob1: 2d0o B:5-112 [131078] Other proteins in same PDB: d2d0oa1, d2d0oa2, d2d0oa3, d2d0oc1, d2d0oc2, d2d0oc3, d2d0od_ complexed with adp, mg, so4 |
PDB Entry: 2d0o (more details), 2 Å
SCOPe Domain Sequences for d2d0ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0ob1 c.51.3.2 (B:5-112) Diol dehydratase-reactivating factor small subunit DdrB {Klebsiella oxytoca [TaxId: 571]}
hsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgia
cdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfr
Timeline for d2d0ob1: