SCOP 1.73: Domain d2d0ob1: 2d0o B:5-112

Lineage for d2d0ob1 (2d0o B:5-112)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families)

5. Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (2 proteins)

6. Protein Diol dehydratase-reactivating factor small subunit DdrB [142424] (1 species)

7. Species Klebsiella oxytoca [TaxId:571] [142425] (2 PDB entries)

8. Domain d2d0ob1: 2d0o B:5-112 [131078]
   Other proteins in same PDB: d2d0oa1, d2d0oa2, d2d0oa3, d2d0oc1, d2d0oc2, d2d0oc3
   complexed with adp, mg, so4

Details for d2d0ob1

PDB Entry: 2d0o, 2 Å

PDB Description: structure of diol dehydratase-reactivating factor complexed with adp and mg2+

PDB Compounds: (B:) diol dehydratase-reactivating factor small subunit

SCOP Domain Sequences for d2d0ob1:

Sequence; same for both SEQRES and ATOM records:

>d2d0ob1 c.51.3.2 (B:5-112) Diol dehydratase-reactivating factor small subunit DdrB {Klebsiella oxytoca [TaxId: 571]}
hsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgia
cdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfr

Timeline for d2d0ob1:

• d2d0ob1 is new in SCOP 1.73
  
• d2d0ob1 appears in SCOP 1.75
  
• d2d0ob1 appears in the current release, SCOPe 2.08