Lineage for d2d0oa1 (2d0o A:93-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851416Superfamily c.8.6: Swiveling domain of dehydratase reactivase alpha subunit [82317] (1 family) (S)
  5. 2851417Family c.8.6.1: Swiveling domain of dehydratase reactivase alpha subunit [82318] (2 proteins)
  6. 2851418Protein Diol dehydratase-reactivating factor large subunit DdrA [141982] (1 species)
  7. 2851419Species Klebsiella oxytoca [TaxId:571] [141983] (2 PDB entries)
    Uniprot O68195 93-254
  8. 2851420Domain d2d0oa1: 2d0o A:93-254 [131075]
    Other proteins in same PDB: d2d0oa2, d2d0oa3, d2d0ob1, d2d0oc2, d2d0oc3, d2d0od_
    complexed with adp, mg, so4

Details for d2d0oa1

PDB Entry: 2d0o (more details), 2 Å

PDB Description: structure of diol dehydratase-reactivating factor complexed with adp and mg2+
PDB Compounds: (A:) diol dehydratase-reactivating factor large subunit

SCOPe Domain Sequences for d2d0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0oa1 c.8.6.1 (A:93-254) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]}
itestmighnpktpggaglgtgititpqelltrpadapyilvvssafdfadiasvinasl
ragyqitgvilqrddgvlvsnrlekplpivdevlyidriplgmlaaievavpgkvietls
npygiatvfnlspeetknivpmaralignrsavvvktpsgdv

SCOPe Domain Coordinates for d2d0oa1:

Click to download the PDB-style file with coordinates for d2d0oa1.
(The format of our PDB-style files is described here.)

Timeline for d2d0oa1: