SCOP 1.73: Domain d2d0nc1: 2d0n C:267-321

Lineage for d2d0nc1 (2d0n C:267-321)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (38 proteins)

6. Protein Grb2-related adaptor protein 2 (Mona/Gads) [89293] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89294] (4 PDB entries)

8. Domain d2d0nc1: 2d0n C:267-321 [131074]
   automatically matched to d1h3ha_

Details for d2d0nc1

PDB Entry: 2d0n, 1.57 Å

PDB Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction

PDB Compounds: (C:) GRB2-related adaptor protein 2

SCOP Domain Sequences for d2d0nc1:

Sequence; same for both SEQRES and ATOM records:

>d2d0nc1 b.34.2.1 (C:267-321) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]}
waralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm

Timeline for d2d0nc1:

• d2d0nc1 is new in SCOP 1.73
  
• d2d0nc1 appears in SCOP 1.75
  
• d2d0nc1 appears in the current release, SCOPe 2.08, called d2d0nc2