Lineage for d2d0nc2 (2d0n C:267-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783337Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)
  8. 2783339Domain d2d0nc2: 2d0n C:267-321 [131074]
    Other proteins in same PDB: d2d0na3, d2d0nc3
    automated match to d1h3ha_

Details for d2d0nc2

PDB Entry: 2d0n (more details), 1.57 Å

PDB Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
PDB Compounds: (C:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d2d0nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0nc2 b.34.2.1 (C:267-321) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
waralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm

SCOPe Domain Coordinates for d2d0nc2:

Click to download the PDB-style file with coordinates for d2d0nc2.
(The format of our PDB-style files is described here.)

Timeline for d2d0nc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d0nc3