SCOPe 2.01: Domain d2d0na_: 2d0n A:

Lineage for d2d0na_ (2d0n A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187043] (2 PDB entries)

8. Domain d2d0na_: 2d0n A: [131073]
   automated match to d1h3ha_

Details for d2d0na_

PDB Entry: 2d0n, 1.57 Å

PDB Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction

PDB Compounds: (A:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d2d0na_:

Sequence; same for both SEQRES and ATOM records:

>d2d0na_ b.34.2.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr

Timeline for d2d0na_:

• d2d0na_ first appeared in SCOP 1.73, called d2d0na1
  
• d2d0na_ was called d2d0na1 in SCOP 1.75
  
• d2d0na_ appears in SCOPe 2.02
  
• d2d0na_ appears in the current release, SCOPe 2.08, called d2d0na2