Lineage for d2d0na1 (2d0n A:267-322)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796291Protein Grb2-related adaptor protein 2 (Mona/Gads) [89293] (1 species)
  7. 796292Species Mouse (Mus musculus) [TaxId:10090] [89294] (4 PDB entries)
  8. 796296Domain d2d0na1: 2d0n A:267-322 [131073]
    automatically matched to d1h3ha_

Details for d2d0na1

PDB Entry: 2d0n (more details), 1.57 Å

PDB Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
PDB Compounds: (A:) GRB2-related adaptor protein 2

SCOP Domain Sequences for d2d0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0na1 b.34.2.1 (A:267-322) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]}
waralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr

SCOP Domain Coordinates for d2d0na1:

Click to download the PDB-style file with coordinates for d2d0na1.
(The format of our PDB-style files is described here.)

Timeline for d2d0na1: