| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Maltogenic amylase [51031] (4 species) |
| Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (9 PDB entries) |
| Domain d2d0ha2: 2d0h A:555-637 [131071] Other proteins in same PDB: d2d0ha1, d2d0ha3 automatically matched to d1izja2 complexed with ca, glc, mpd; mutant |
PDB Entry: 2d0h (more details), 2.1 Å
SCOP Domain Sequences for d2d0ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0ha2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq
Timeline for d2d0ha2: