Lineage for d2d0ga3 (2d0g A:123-554)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682482Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 682486Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75061] (9 PDB entries)
  8. 682495Domain d2d0ga3: 2d0g A:123-554 [131069]
    Other proteins in same PDB: d2d0ga1, d2d0ga2
    automatically matched to d1izja3
    complexed with ca, glc, mpd; mutant

Details for d2d0ga3

PDB Entry: 2d0g (more details), 2.6 Å

PDB Description: Crystal Structure of Thermoactinomyces vulgaris R-47 Alpha-Amylase 1 (TVAI) Mutant D356N/E396Q complexed with P5, a pullulan model oligosaccharide
PDB Compounds: (A:) alpha-amylase I

SCOP Domain Sequences for d2d0ga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0ga3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrlnaaqyvd
angnngsdvtnhqiwsefrnavkgvnsnaaiigqywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

SCOP Domain Coordinates for d2d0ga3:

Click to download the PDB-style file with coordinates for d2d0ga3.
(The format of our PDB-style files is described here.)

Timeline for d2d0ga3: