SCOPe 2.01: Domain d2d0ga2: 2d0g A:555-637

Lineage for d2d0ga2 (2d0g A:555-637)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (9 PDB entries)

8. Domain d2d0ga2: 2d0g A:555-637 [131068]
   Other proteins in same PDB: d2d0ga1, d2d0ga3
   automatically matched to d1izja2
   complexed with bgc, ca, glc, mpd; mutant

Details for d2d0ga2

PDB Entry: 2d0g, 2.6 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n/e396q complexed with p5, a pullulan model oligosaccharide

PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0ga2:

Sequence; same for both SEQRES and ATOM records:

>d2d0ga2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

Timeline for d2d0ga2:

• d2d0ga2 first appeared in SCOP 1.73
  
• d2d0ga2 appears in SCOP 1.75
  
• d2d0ga2 appears in SCOPe 2.02
  
• d2d0ga2 appears in the current release, SCOPe 2.08