Lineage for d2d0ga1 (2d0g A:1-122)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (8 PDB entries)
  8. Domain d2d0ga1: 2d0g A:1-122 [131067]
    Other proteins in same PDB: d2d0ga2, d2d0ga3
    automated match to d1uh4a1
    complexed with bgc, ca, glc, mpd; mutant

Details for d2d0ga1

PDB Entry: 2d0g (more details), 2.6 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n/e396q complexed with p5, a pullulan model oligosaccharide
PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0ga1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOPe Domain Coordinates for d2d0ga1 are not available.

Timeline for d2d0ga1:

Domains from same chain:
(mouse over for more information)
d2d0ga2, d2d0ga3