Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (9 PDB entries) |
Domain d2d0fa2: 2d0f A:555-637 [131065] Other proteins in same PDB: d2d0fa1, d2d0fa3 automatically matched to d1izja2 complexed with ca, glc, mpd; mutant |
PDB Entry: 2d0f (more details), 2.08 Å
SCOP Domain Sequences for d2d0fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0fa2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh sytvqngmvtvavdghygavlaq
Timeline for d2d0fa2: