Lineage for d2d0fa2 (2d0f A:555-637)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808407Protein Maltogenic amylase [51031] (4 species)
  7. 808411Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (9 PDB entries)
  8. 808415Domain d2d0fa2: 2d0f A:555-637 [131065]
    Other proteins in same PDB: d2d0fa1, d2d0fa3
    automatically matched to d1izja2
    complexed with ca, glc, mpd; mutant

Details for d2d0fa2

PDB Entry: 2d0f (more details), 2.08 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n complexed with p2, a pullulan model oligosaccharide
PDB Compounds: (A:) alpha-amylase I

SCOP Domain Sequences for d2d0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0fa2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOP Domain Coordinates for d2d0fa2:

Click to download the PDB-style file with coordinates for d2d0fa2.
(The format of our PDB-style files is described here.)

Timeline for d2d0fa2: