Lineage for d2d07b1 (2d07 B:15-89)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717193Protein SUMO-2 [117816] (1 species)
  7. 717194Species Human (Homo sapiens) [TaxId:9606] [117817] (10 PDB entries)
  8. 717197Domain d2d07b1: 2d07 B:15-89 [131063]
    automatically matched to d1wm2a_

Details for d2d07b1

PDB Entry: 2d07 (more details), 2.1 Å

PDB Description: Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
PDB Compounds: (B:) Ubiquitin-like protein SMT3B

SCOP Domain Sequences for d2d07b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d07b1 d.15.1.1 (B:15-89) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqq

SCOP Domain Coordinates for d2d07b1:

Click to download the PDB-style file with coordinates for d2d07b1.
(The format of our PDB-style files is described here.)

Timeline for d2d07b1: