Lineage for d2d06a1 (2d06 A:8-295)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695512Family c.37.1.5: PAPS sulfotransferase [52575] (13 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 695513Protein Aryl sulfotransferase sult1a [102346] (1 species)
  7. 695514Species Human (Homo sapiens) [TaxId:9606] [102347] (2 PDB entries)
  8. 695516Domain d2d06a1: 2d06 A:8-295 [131061]
    automatically matched to d1ls6a_
    complexed with a3p, est

Details for d2d06a1

PDB Entry: 2d06 (more details), 2.3 Å

PDB Description: human sult1a1 complexed with pap and estradiol
PDB Compounds: (A:) Sulfotransferase 1A1

SCOP Domain Sequences for d2d06a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d06a1 c.37.1.5 (A:8-295) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOP Domain Coordinates for d2d06a1:

Click to download the PDB-style file with coordinates for d2d06a1.
(The format of our PDB-style files is described here.)

Timeline for d2d06a1: