Lineage for d2d03h_ (2d03 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (616 PDB entries)
  8. 2744306Domain d2d03h_: 2d03 H: [131060]
    Other proteins in same PDB: d2d03l2
    automated match to d6shgh_
    complexed with gol, mes, peg; mutant

Details for d2d03h_

PDB Entry: 2d03 (more details), 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab
PDB Compounds: (H:) anti-glycophorin A type N immunoglobulin heavy chain

SCOPe Domain Sequences for d2d03h_:

Sequence, based on SEQRES records: (download)

>d2d03h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdyna
afisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssakt
tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d2d03h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdyna
afisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssakt
tppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
vpsstwpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d2d03h_:

Click to download the PDB-style file with coordinates for d2d03h_.
(The format of our PDB-style files is described here.)

Timeline for d2d03h_: