![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (616 PDB entries) |
![]() | Domain d2d03h_: 2d03 H: [131060] Other proteins in same PDB: d2d03l2 automated match to d6shgh_ complexed with gol, mes, peg; mutant |
PDB Entry: 2d03 (more details), 1.97 Å
SCOPe Domain Sequences for d2d03h_:
Sequence, based on SEQRES records: (download)
>d2d03h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdyna afisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssakt tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt lsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
>d2d03h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qlleesgpglvqpsqslsitctvsgfsltsygvhwvrqspgkglewlgviwsggstdyna afisrlsiskdnsksqvffkmnslqaddtaiyycarnrgysyamdswgqgtsvtvssakt tppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt vpsstwpsetvtcnvahpasstkvdkkivprd
Timeline for d2d03h_: