SCOPe 2.05: Domain d2czwa1: 2czw A:7-124

Lineage for d2czwa1 (2czw A:7-124)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries)

8. Domain d2czwa1: 2czw A:7-124 [131058]
   automatically matched to d1pxwa_

Details for d2czwa1

PDB Entry: 2czw, 1.9 Å

PDB Description: Crystal structure analysis of protein component Ph1496p of P.horikoshii ribonuclease P

PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d2czwa1:

Sequence; same for both SEQRES and ATOM records:

>d2czwa1 d.79.3.1 (A:7-124) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]}
yvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeivah
lpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk

Timeline for d2czwa1:

• d2czwa1 first appeared in SCOP 1.73
  
• d2czwa1 appears in SCOPe 2.04
  
• d2czwa1 appears in SCOPe 2.06
  
• d2czwa1 appears in the current release, SCOPe 2.08