Lineage for d2czwa1 (2czw A:7-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960098Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2960115Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2960188Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries)
  8. 2960189Domain d2czwa1: 2czw A:7-124 [131058]
    automatically matched to d1pxwa_

Details for d2czwa1

PDB Entry: 2czw (more details), 1.9 Å

PDB Description: Crystal structure analysis of protein component Ph1496p of P.horikoshii ribonuclease P
PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d2czwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czwa1 d.79.3.1 (A:7-124) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]}
yvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeivah
lpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk

SCOPe Domain Coordinates for d2czwa1:

Click to download the PDB-style file with coordinates for d2czwa1.
(The format of our PDB-style files is described here.)

Timeline for d2czwa1: