SCOP 1.75: Domain d2czvb1: 2czv B:7-208

Lineage for d2czvb1 (2czv B:7-208)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.3: PHP domain-like [89550] (2 families)

5. Family c.6.3.2: RNase P subunit p30 [110442] (1 protein)
   Pfam PF01876

6. Protein Ribonuclease P protein component 3, Rnp3 [110443] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [110444] (2 PDB entries)
   Uniprot O59543 # PH1877

8. Domain d2czvb1: 2czv B:7-208 [131057]
   Other proteins in same PDB: d2czvc1, d2czvd1
   automatically matched to d1v77a_
   complexed with acy, bog; mutant

Details for d2czvb1

PDB Entry: 2czv, 2 Å

PDB Description: crystal structure of archeal rnase p protein ph1481p in complex with ph1877p

PDB Compounds: (B:) Ribonuclease P protein component 3

SCOP Domain Sequences for d2czvb1:

Sequence; same for both SEQRES and ATOM records:

>d2czvb1 c.6.3.2 (B:7-208) Ribonuclease P protein component 3, Rnp3 {Pyrococcus horikoshii [TaxId: 53953]}
vkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsnpkpsl
vrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmvkknva
lgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdlislgv
vigmeipqakasismypeiilk

Timeline for d2czvb1:

• d2czvb1 first appeared in SCOP 1.73
  
• d2czvb1 is called d2czvb_ in SCOPe 2.01
  
• d2czvb1 appears in the current release, SCOPe 2.08, called d2czvb_