Lineage for d2czjg1 (2czj G:4-123)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430448Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 2430449Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 2430450Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 2430451Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 2430456Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries)
    Uniprot Q8RR57 4-123
  8. 2430461Domain d2czjg1: 2czj G:4-123 [131054]
    automatically matched to d1j1ha_
    protein/RNA complex

Details for d2czjg1

PDB Entry: 2czj (more details), 3.01 Å

PDB Description: Crystal structure of the tRNA domain of tmRNA from Thermus thermophilus HB8
PDB Compounds: (G:) SsrA-binding protein

SCOPe Domain Sequences for d2czjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czjg1 b.111.1.1 (G:4-123) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapy
ekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk

SCOPe Domain Coordinates for d2czjg1:

Click to download the PDB-style file with coordinates for d2czjg1.
(The format of our PDB-style files is described here.)

Timeline for d2czjg1: