Class b: All beta proteins [48724] (165 folds) |
Fold b.111: Small protein B (SmpB) [74981] (1 superfamily) barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold |
Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) |
Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein) |
Protein Small protein B (SmpB) [74984] (2 species) tmRNA-binding protein; SsrA-binding protein |
Species Thermus thermophilus [TaxId:274] [82130] (3 PDB entries) |
Domain d2czjg1: 2czj G:4-123 [131054] automatically matched to d1j1ha_ complexed with 5mu, psu |
PDB Entry: 2czj (more details), 3.01 Å
SCOP Domain Sequences for d2czjg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czjg1 b.111.1.1 (G:4-123) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]} vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapy ekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk
Timeline for d2czjg1: