Lineage for d2czfb1 (2czf B:1-208)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681364Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 681395Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 681467Species Pyrococcus horikoshii [TaxId:53953] [141748] (4 PDB entries)
  8. 681475Domain d2czfb1: 2czf B:1-208 [131050]
    automatically matched to 2CZ5 A:1-208
    complexed with xmp

Details for d2czfb1

PDB Entry: 2czf (more details), 1.85 Å

PDB Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with XMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d2czfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czfb1 c.1.2.3 (B:1-208) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]}
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirgv

SCOP Domain Coordinates for d2czfb1:

Click to download the PDB-style file with coordinates for d2czfb1.
(The format of our PDB-style files is described here.)

Timeline for d2czfb1: