![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [141748] (4 PDB entries) Uniprot O58462 1-208 |
![]() | Domain d2czeb_: 2cze B: [131048] automated match to d2cz5a1 complexed with cit, gol, u5p |
PDB Entry: 2cze (more details), 1.85 Å
SCOPe Domain Sequences for d2czeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czeb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad yiivgraiynapnpreaakaiydeirgv
Timeline for d2czeb_: