Lineage for d2czeb_ (2cze B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435437Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2435477Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2435545Species Pyrococcus horikoshii [TaxId:53953] [141748] (4 PDB entries)
    Uniprot O58462 1-208
  8. 2435549Domain d2czeb_: 2cze B: [131048]
    automated match to d2cz5a1
    complexed with cit, gol, u5p

Details for d2czeb_

PDB Entry: 2cze (more details), 1.85 Å

PDB Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with UMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2czeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czeb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]}
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirgv

SCOPe Domain Coordinates for d2czeb_:

Click to download the PDB-style file with coordinates for d2czeb_.
(The format of our PDB-style files is described here.)

Timeline for d2czeb_: