SCOPe 2.05: Domain d2czeb_: 2cze B:

Lineage for d2czeb_ (2cze B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141748] (4 PDB entries)
   Uniprot O58462 1-208

8. Domain d2czeb_: 2cze B: [131048]
   automated match to d2cz5a1
   complexed with cit, gol, u5p

Details for d2czeb_

PDB Entry: 2cze, 1.85 Å

PDB Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with UMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2czeb_:

Sequence; same for both SEQRES and ATOM records:

>d2czeb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]}
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirgv

Timeline for d2czeb_:

• d2czeb_ first appeared in SCOP 1.73, called d2czeb1
  
• d2czeb_ appears in SCOPe 2.04
  
• d2czeb_ appears in SCOPe 2.06
  
• d2czeb_ appears in the current release, SCOPe 2.08