Lineage for d2czeb1 (2cze B:1-208)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814479Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 814551Species Pyrococcus horikoshii [TaxId:53953] [141748] (4 PDB entries)
    Uniprot O58462 1-208
  8. 814555Domain d2czeb1: 2cze B:1-208 [131048]
    automatically matched to 2CZ5 A:1-208
    complexed with cit, gol, u5p

Details for d2czeb1

PDB Entry: 2cze (more details), 1.85 Å

PDB Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with UMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d2czeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czeb1 c.1.2.3 (B:1-208) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]}
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirgv

SCOP Domain Coordinates for d2czeb1:

Click to download the PDB-style file with coordinates for d2czeb1.
(The format of our PDB-style files is described here.)

Timeline for d2czeb1: