SCOP 1.75: Domain d2czdb1: 2czd B:1-207

Lineage for d2czdb1 (2czd B:1-207)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.3: Decarboxylase [51375] (3 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141748] (4 PDB entries)
   Uniprot O58462 1-208

8. Domain d2czdb1: 2czd B:1-207 [131046]
   automatically matched to 2CZ5 A:1-208
   complexed with dtt, gol

Details for d2czdb1

PDB Entry: 2czd, 1.6 Å

PDB Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 at 1.6 A resolution

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOP Domain Sequences for d2czdb1:

Sequence; same for both SEQRES and ATOM records:

>d2czdb1 c.1.2.3 (B:1-207) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]}
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirg

Timeline for d2czdb1:

• d2czdb1 first appeared in SCOP 1.73
  
• d2czdb1 is called d2czdb_ in SCOPe 2.01
  
• d2czdb1 appears in the current release, SCOPe 2.08, called d2czdb_