Lineage for d2czca1 (2czc A:140-301)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961822Species Pyrococcus horikoshii [TaxId:53953] [143537] (1 PDB entry)
    Uniprot O59494 140-301
  8. 2961823Domain d2czca1: 2czc A:140-301 [131044]
    Other proteins in same PDB: d2czca2, d2czcb1, d2czcc1, d2czcd1
    complexed with nad, po4

Details for d2czca1

PDB Entry: 2czc (more details), 2 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2czca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Pyrococcus horikoshii [TaxId: 53953]}
scnttglvrtlsaireyadyvyavmirraadpndtkrgpinaikptvevpshhgpdvqtv
ipinietmafvvpttlmhvhsvmvelkkpltkddvidifenttrvllfekekgfdstaqi
iefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd

SCOPe Domain Coordinates for d2czca1:

Click to download the PDB-style file with coordinates for d2czca1.
(The format of our PDB-style files is described here.)

Timeline for d2czca1: